PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.041700.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family WRKY
Protein Properties Length: 753aa    MW: 81749.2 Da    PI: 6.7993
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.041700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1023.4e-32331388260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     +DgynWrKYGqK+vkgse+prsYY+Ct+++C+vkkkvers+ +++++ei+Y+g+Hnh+k
  Cucsa.041700.1 331 EDGYNWRKYGQKQVKGSEYPRSYYKCTHPNCQVKKKVERSH-EGHITEIIYKGTHNHPK 388
                     7****************************************.***************85 PP

2WRKY103.11.5e-32545603159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vkg+++prsYY+Ct +gC+v+k+ver+++d k v++tYeg+Hnh+
  Cucsa.041700.1 545 LDDGYRWRKYGQKVVKGNPNPRSYYKCTNPGCTVRKHVERASHDLKSVITTYEGKHNHD 603
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.807.9E-28328389IPR003657WRKY domain
SuperFamilySSF1182905.62E-25329389IPR003657WRKY domain
SMARTSM007741.2E-35330388IPR003657WRKY domain
PfamPF031067.3E-25331387IPR003657WRKY domain
PROSITE profilePS5081123.158331389IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.5E-37530605IPR003657WRKY domain
SuperFamilySSF1182901.44E-28537605IPR003657WRKY domain
PROSITE profilePS5081138.124540605IPR003657WRKY domain
SMARTSM007747.5E-38545604IPR003657WRKY domain
PfamPF031068.4E-25546603IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0009942Biological Processlongitudinal axis specification
GO:0030010Biological Processestablishment of cell polarity
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 753 aa     Download sequence    Send to blast
MGRTDDNIAI IGDWVPPSPS PRTFFSAMQM LGEDIGSKPS MDTTTISDHK TEELFLRPRE  60
QTVSENAFAR GGIPGVNSGD RGMEFSTFSE QKFRGGLVER IAARAGFNAP RLNTESIRST  120
DHSLNSEVKS PYLTIPPGLS PTTLLDSPVF LSNSLAQQSP TTGKFPFLPN VCISRSSTMM  180
SEANNKGNNN LFDDNNTSFA FRPGVESGSS FFLNAASKTA SATILPQSCP RIEVPVPRSE  240
NSFQSHRVEP SLSLPQNRIG HHPQVGLSTT YVEKDNGGKA VSEEQRPFDS LGGGSGGSGE  300
HSSPLDEQLD EGEQRGSGDS MAGGACGTPS EDGYNWRKYG QKQVKGSEYP RSYYKCTHPN  360
CQVKKKVERS HEGHITEIIY KGTHNHPKPS PNRRGAIGSS DSHMNMQLDI PAQAGQQSAD  420
VPLWEDSQKR VPSGAPDWMH ENLEVTSSAS LGPEYGNQPN SLQAQNGSHI ETVEAIDASS  480
TFSNDEDEDD RGTHGSITLG YEGEGDESES KKRKLDAYVT EMSGATRAIR EPRVVVQTTS  540
EVDILDDGYR WRKYGQKVVK GNPNPRSYYK CTNPGCTVRK HVERASHDLK SVITTYEGKH  600
NHDVPAARNS SHISSGTSSP VTGQNSTAAI QTHVHRPGPS QPQNTIPRFE RPAFGFAGRQ  660
QMGPAHGFAF GMNQPGLGNL TMAAVGQPKL PVLPMHAYLG QAHHVNEMGF LLPKGEPNVE  720
PTSDLGFSSG STGWGRMHWL IKFSKQTIQN NS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-37331606878Probable WRKY transcription factor 4
2lex_A2e-37331606878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00071PBMTransfer from AT5G56270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU9840160.0GU984016.1 Cucumis sativus WRKY protein (WRKY16) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004148275.10.0PREDICTED: probable WRKY transcription factor 2
SwissprotQ9FG770.0WRKY2_ARATH; Probable WRKY transcription factor 2
TrEMBLE7CEW50.0E7CEW5_CUCSA; WRKY protein
STRINGVIT_19s0015g01870.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95243443
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.10.0WRKY DNA-binding protein 2